PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold05987-augustus-gene-0.18-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB
Protein Properties Length: 319aa    MW: 35942.1 Da    PI: 6.1693
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold05987-augustus-gene-0.18-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.7e-152269148
                                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                                Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                                   +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
  maker-scaffold05987-augustus-gene-0.18-mRNA-1 22 KGLWSPEEDDKLMNYMMNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 69
                                                   678*******************************************97 PP

2Myb_DNA-binding47.25.1e-1575118146
                                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                                Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                                    rg+++++E+  +++++ +lG++ W+ Ia++++ gRt++++k++w++
  maker-scaffold05987-augustus-gene-0.18-mRNA-1  75 RGAFSPQEEAHIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 118
                                                    89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-241572IPR009057Homeodomain-like
PROSITE profilePS5129416.1381769IPR017930Myb domain
SuperFamilySSF466891.52E-2720116IPR009057Homeodomain-like
SMARTSM007172.5E-102171IPR001005SANT/Myb domain
PfamPF002498.4E-142269IPR001005SANT/Myb domain
CDDcd001677.73E-92569No hitNo description
PROSITE profilePS5129424.14970124IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2573125IPR009057Homeodomain-like
SMARTSM007171.3E-1374122IPR001005SANT/Myb domain
PfamPF002495.1E-1475118IPR001005SANT/Myb domain
CDDcd001672.04E-977117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MRKPELSSVG KNNHVNNNKL RKGLWSPEED DKLMNYMMNN GQGCWSDVAR NAGLQRCGKS  60
CRLRWINYLR PDLKRGAFSP QEEAHIIHLH SLLGNRWSQI AARLPGRTDN EIKNFWNSTI  120
KKRLKNFSST PSPNTSDSSS PKDVMGGLIS MQEQGIMPLY LDSSSSTTNS MQAMTLNHMI  180
DPLPMIHHGL NMSNNASGYF NAAPQYMTQI GVNGDSFYGG NGVFGGADMG LENELFVPPL  240
ESISIEENDK TENMYNKRTM NNNTSNNLNN ISNCSNNNNR AENLARVGNY WEGEELRMGE  300
WDFEELMDVP SFPLLDFSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261512420128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015571138.11e-139PREDICTED: transcription factor MYB46
TrEMBLA0A061GTG81e-132A0A061GTG8_THECC; Myb domain protein 46, putative
STRINGVIT_06s0004g02110.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.15e-71myb domain protein 46